P2X5 (P2RX5) Rabbit Polyclonal Antibody
CAT#: TA338778
Rabbit Polyclonal Anti-P2RX5 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 3080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-P2RX5 antibody: synthetic peptide directed towards the N terminal of human P2RX5. Synthetic peptide located within the following region: LLQASILAYLVVWVFLIKKGYQDVDTSLQSAVITKVKGVAFTNTSDLGQR |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 47 kDa |
Gene Name | purinergic receptor P2X 5 |
Database Link | |
Background | The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the neighboring downstream gene, TAX1BP3 (Tax1 binding protein 3). [provided by RefSeq, Mar 2011] |
Synonyms | 5; ligand-gated ion channel; LRH-1; MGC47755; P2X5; P2x5; P2X5R; purinergic receptor P2X; purinergic receptor P2X5 |
Note | Immunogen Sequence Homology: Human: 100%; Pig: 92%; Rat: 92%; Guinea pig: 92%; Mouse: 86%; Bovine: 85%; Rabbit: 79%; Dog: 77% |
Reference Data | |
Protein Families | Druggable Genome, Ion Channels: ATP Receptors, Transmembrane |
Protein Pathways | Calcium signaling pathway, Neuroactive ligand-receptor interaction |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |