BBS5 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-BBS5 antibody: synthetic peptide directed towards the N terminal of human BBS5. Synthetic peptide located within the following region: MSVLDALWEDRDVRFDLSAQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	Bardet-Biedl syndrome 5
Database Link	NP_689597 Entrez Gene 129880 Human UniProt ID Q8N3I7
Background	BBS5 is a protein that has been directly linked to Bardet-Biedl syndrome. The primary features of this syndrome include retinal dystrophy, obesity, polydactyly, renal abnormalities and learning disabilities. Experimentation in non-human eukaryotes suggests that this gene is expressed in ciliated cells and that it is required for the formation of cilia.
Synonyms	Bardet-Biedl syndrome 5; DKFZp762I194
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Bovine: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.