PSMG1 Rabbit Polyclonal Antibody

CAT#: TA338919

Rabbit Polyclonal Anti-PSMG1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (4)
Transient overexpression lysate of proteasome (prosome, macropain) assembly chaperone 1 (PSMG1), transcript variant 1
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human proteasome (prosome, macropain) assembly chaperone 1 (PSMG1), transcript variant 1, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human proteasome (prosome, macropain) assembly chaperone 1 (PSMG1), transcript variant 1, 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-PSMG1 antibody: synthetic peptide directed towards the middle region of human PSMG1. Synthetic peptide located within the following region: VMKLDLITVEAFKPILSTRSLKGLVKNIPQSTEILKKLMTTNEIQSNIYT
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 33 kDa
Gene Name proteasome assembly chaperone 1
Background PSMG1 is a chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with PSMG2. The PSMG1-PSMG2 heterodimer binds to the PSMA5 and PSMA7 proteasome subunits, promotes assembly of the proteasome alpha subunits into the heteroheptameric alpha ring and prevents alpha ring dimerization.
Synonyms C21LRP; DSCR2; LRPC21; PAC-1; PAC1
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Guinea pig: 92%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...