GATD3 Rabbit Polyclonal Antibody
CAT#: TA338921
Rabbit Polyclonal Anti-C21orf33 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-C21orf33 antibody: synthetic peptide directed towards the N terminal of human C21orf33. Synthetic peptide located within the following region: SRGGAEVQIFAPDVPQMHVIDHTKGQPSEGESRNVLTESARIARGKITDL |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 21 kDa |
Gene Name | chromosome 21 open reading frame 33 |
Database Link | |
Background | This gene encodes a potential mitochondrial protein that is a member of the DJ-1/PfpI gene family. This protein is overexpressed in fetal Down syndrome brain. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2010] |
Synonyms | ES1; GT335; HES1; KNPH; KNPI |
Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Sheep: 93%; Bovine: 93%; Mouse: 92%; Pig: 86%; Horse: 86%; Zebrafish: 86%; Guinea pig: 86% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |