FAM3B Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-FAM3B antibody is: synthetic peptide directed towards the middle region of Human FAM3B. Synthetic peptide located within the following region: HWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIV
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	30 kDa
Gene Name	family with sequence similarity 3 member B
Database Link	NP_996847 Entrez Gene 54097 Human UniProt ID P58499
Background	FAM3B induces apoptosis of alpha and beta cells in a dose- and time-dependent manner.
Synonyms	2-21; C21orf11; C21orf76; ORF9; PANDER; PRED44
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Pig: 86%; Rat: 86%; Guinea pig: 86%
Reference Data
Protein Families	Druggable Genome, Secreted Protein, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.