PARVB Rabbit Polyclonal Antibody
CAT#: TA338970
Rabbit Polyclonal Anti-PARVB Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-PARVB antibody: synthetic peptide directed towards the N terminal of human PARVB. Synthetic peptide located within the following region: LQEEGKNAINSPMSPALVDVHPEDTQLEENEERTMIDPTSKEDPKFKELV |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 45 kDa |
Gene Name | parvin beta |
Database Link | |
Background | This gene encodes a member of the parvin family of actin-binding proteins, which play a role in cytoskeleton organization and cell adhesion. These proteins are associated with focal contacts and contain calponin homology domains that bind to actin filaments. This family member binds to alphaPIX and alpha-actinin, and it can inhibit the activity of integrin-linked kinase. This protein also functions in tumor suppression. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Aug 2011] |
Synonyms | CGI-56 |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 93%; Horse: 86%; Bovine: 86%; Zebrafish: 85% |
Reference Data | |
Protein Pathways | Focal adhesion |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |