Timm17a Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Timm17a antibody is: synthetic peptide directed towards the N-terminal region of Rat Timm17a. Synthetic peptide located within the following region: DCGGAFTMGTIGGGIFQAFKGFRNSPVGVNHRLRGSLTAIKTRAPQLGGS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	18 kDa
Gene Name	translocase of inner mitochondrial membrane 17 homolog A (yeast)
Database Link	NP_062224 Entrez Gene 54311 Rat UniProt ID O35092
Background	human homolog is a translocase in the inner mitochondrial membrane [RGD, Feb 2006]. Sequence Note: This sequence has been modified as follows: removed 46 bp suspected to be vector contamination from the 3' end. ##Evidence-Data-START## Transcript exon combination :: AB006450.1, DV715276.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SRS369727 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## gene product(s) localized to mito. :: inferred from homology ##RefSeq-Attributes-END##
Synonyms	MIMT17; TIM17; TIM17A; TIMM17
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.