LRRFIP1 Rabbit Polyclonal Antibody

CAT#: TA339099

Rabbit Polyclonal Anti-Lrrfip1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (4)
Transient overexpression lysate of leucine rich repeat (in FLII) interacting protein 1 (LRRFIP1), transcript variant 4
    • 100 ug

CNY 4840.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human leucine rich repeat (in FLII) interacting protein 1 (LRRFIP1), transcript variant 4, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human leucine rich repeat (in FLII) interacting protein 1 (LRRFIP1), transcript variant 4, 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Mouse
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-Lrrfip1 antibody is: synthetic peptide directed towards the middle region of Mouse Lrrfip1. Synthetic peptide located within the following region: IREIKELNELKDQIQDVEGKYMQGLKEMKDSLAEVEEKYKKAMVSNAQLD
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 49 kDa
Gene Name leucine rich repeat (in FLII) interacting protein 1
Background Transcriptional repressor which preferentially binds to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA. May control smooth muscle cells proliferation following artery injury through PDGFA repression. May also bind double-stranded RNA (By similarity). Positively regulates Toll-like receptor (TLR) signaling in response to agonist probably by competing with the negative FLII regulator for MYD88-binding.
Synonyms FLAP-1; FLAP1; FLIIAP1; GCF-2; GCF2; HUFI-1; TRIP
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%
Reference Data
Protein Families Transcription Factors
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...