GABARAP Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human, Insect, Cow, Dog, Mouse, Pig, Rabbit, Rat, Zebrafish
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GABARAP antibody: synthetic peptide directed towards the N terminal of human GABARAP. Synthetic peptide located within the following region: IRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	14 kDa
Gene Name	GABA type A receptor-associated protein
Database Link	NP_009209 Entrez Gene 56486 MouseEntrez Gene 58974 RatEntrez Gene 479479 DogEntrez Gene 11337 Human UniProt ID O95166
Background	Gamma-aminobutyric acid A receptors [GABA(A) receptors] are ligand-gated chloride channels that mediate inhibitory neurotransmission. GABA(A) receptor-associated protein (GABARAP) is highly positively charged in its N-terminus and shares sequence similarity with light chain-3 of microtubule-associated proteins 1A and 1B. This protein clusters neurotransmitter receptors by mediating interaction with the cytoskeleton.
Synonyms	ATG8A; GABARAP-a; MM46
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Horse: 79%; Guinea pig: 79%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Regulation of autophagy

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.