FZR1 Rabbit Polyclonal Antibody
CNY 4,628.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 3,080.00
CNY 9,998.00
CNY 3,080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-FZR1 antibody: synthetic peptide directed towards the N terminal of human FZR1. Synthetic peptide located within the following region: SSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKSPSQNRKAKDATSDN |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 55 kDa |
Gene Name | fizzy/cell division cycle 20 related 1 |
Database Link | |
Background | FZR1 is a key regulator of ligase activity of the anaphase promoting complex/cyclosome (APC/C), which confers substrate specificity upon the complex. FZR1 associates with the APC/C in late mitosis, in replacement of CDC20, and activates the APC/C during anaphase and telophase. The APC/C remains active in degrading substrates to ensure that positive regulators of the cell cycle do not accumulate prematurely. At the G1/S transition FZR1 is phosphorylated, leading to its dissociation from the APC/C. Following DNA damage, it is required for the G2 DNA damage checkpoint: its dephosphorylation and reassociation with the APC/C leads to the ubiquitination of PLK1, preventing entry into mitosis. |
Synonyms | CDC20C; CDH1; FZR; FZR2; HCDH; HCDH1 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Cell cycle, Progesterone-mediated oocyte maturation, Ubiquitin mediated proteolysis |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |