TRIP6 Rabbit Polyclonal Antibody
CNY 4628.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-TRIP6 antibody: synthetic peptide directed towards the N terminal of human TRIP6. Synthetic peptide located within the following region: MSGPTWLPPKQPEPARAPQGRAIPRGTPGPPPAHGAALQPHPRVNFCPLP |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Concentration | lot specific |
| Purification | Protein A purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 50 kDa |
| Gene Name | thyroid hormone receptor interactor 6 |
| Database Link | |
| Background | TRIP6 is a member of the zyxin family and encodes a protein with three LIM zinc-binding domains. This protein localizes to focal adhesion sites and along actin stress fibers. Recruitment of TRIP6 to the plasma membrane occurs in a lysophosphatidic acid (LPA)-dependent manner and it regulates LPA-induced cell migration.This gene is a member of the zyxin family and encodes a protein with three LIM zinc-binding domains. This protein localizes to focal adhesion sites and along actin stress fibers. Recruitment of this protein to the plasma membrane occurs in a lysophosphatidic acid (LPA)-dependent manner and it regulates LPA-induced cell migration. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Synonyms | OIP-1; OIP1; TRIP-6; TRIP6i2; ZRP-1 |
| Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 93%; Dog: 86%; Mouse: 86% |
| Reference Data | |
| Protein Families | Druggable Genome |
| Protein Pathways | NOD-like receptor signaling pathway |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
