KLHDC5 (KLHL42) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-KLHDC5 antibody: synthetic peptide directed towards the middle region of human KLHDC5. Synthetic peptide located within the following region: IVGGCLHELGPNRRSSQSEDMLTVQSYNTVTRQWLYLKENTSKSGLNLTC
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	57 kDa
Gene Name	kelch like family member 42
Database Link	NP_065833 Entrez Gene 57542 Human UniProt ID Q9P2K6
Background	KLHL42 contains 1 BTB (POZ) domain and 6 Kelch repeats. It is phosphorylated upon DNA damage, probably by ATM or ATR. The exact functions of KLHL42 remain unknown.
Synonyms	Ctb9; KLHDC5
Note	Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rat: 93%; Guinea pig: 93%; Bovine: 86%; Rabbit: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.