Adam22 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Adam22 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AISENPLITLREFMKYRRDFIKEKADAVHLFSGSQFESSRSGAAYIGGIC
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	91 kDa
Gene Name	a disintegrin and metallopeptidase domain 22
Database Link	NP_001007222 Entrez Gene 11496 Mouse UniProt ID Q9R1V6
Background	Adam22 is a probable ligand for integrin in the brain. This is a non catalytic metalloprotease-like protein. Adam22 is involved in regulation of cell adhesion and spreading and in inhibition of cell proliferation.Adam22 is a neuronal receptor for LGI1.
Synonyms	MDC2; MGC149832
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.