FCRL4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-FCRL4 antibody: synthetic peptide directed towards the N terminal of human FCRL4. Synthetic peptide located within the following region: FKGERVTLTCNGFQFYATEKTTWYHRHYWGEKLTLTPGNTLEVRESGLYR
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	57 kDa
Gene Name	Fc receptor like 4
Database Link	NP_112572 Entrez Gene 83417 Human UniProt ID Q96PJ5
Background	FCRL4 may function as an inhibitor of the B cell receptor signaling and in the B cell-mediated immune response.
Synonyms	CD307d; FCRH4; IGFP2; IRTA1
Note	Immunogen Sequence Homology: Human: 100%; Pig: 85%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.