TLCD3B Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-FAM57B antibody is: synthetic peptide directed towards the C-terminal region of Human FAM57B. Synthetic peptide located within the following region: WAYGRHAGLPLLAVPLAIPAHVNLGAALLLAPQLYWFFLICRGACRLFWP
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	24 kDa
Gene Name	family with sequence similarity 57 member B
Database Link	NP_113666 Entrez Gene 83723 Human UniProt ID Q71RH2
Background	FAM57B is involved in ceramide synthesis.
Synonyms	FP1188
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Horse: 93%; Mouse: 86%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.