TSPAN10 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TSPAN10 antibody: synthetic peptide directed towards the N terminal of human TSPAN10. Synthetic peptide located within the following region: SCVKYLIFLSNFPFSLLGLLALAIGLWGLAVKGSLGSDLGGPLPADPMLG
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	tetraspanin 10
Database Link	NP_114151 Entrez Gene 83882 Human UniProt ID Q9H1Z9
Background	TSPAN10 belongs to the tetraspanin (TM4SF) family. It is a multi-pass membrane protein. The exact function of TSPAN10 remains unknown.
Synonyms	OCSP
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.