TMEM79 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TMEM79 antibody: synthetic peptide directed towards the C terminal of human TMEM79. Synthetic peptide located within the following region: LPLLSMLMWNLYYMFVVEPERMLTATESRLDYPDHARSASDYRPRPWG
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	43 kDa
Gene Name	transmembrane protein 79
Database Link	NP_115699 Entrez Gene 84283 Human UniProt ID Q9BSE2
Background	TMEM79 is a multi-pass membrane protein. The exact function of TMEM79 remains unknown.
Synonyms	MATT
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Mouse: 93%; Guinea pig: 93%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.