TMEM158 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SEC22C antibody: synthetic peptide directed towards the middle region of human SEC22C. Synthetic peptide located within the following region: FRMEPVTALGILSLILNIMCAALNLIRGVHLAEHSLQVAHEEIGNILAFL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	34 kDa
Gene Name	transmembrane protein 158 (gene/pseudogene)
Database Link	NP_056259 Entrez Gene 25907 Human UniProt ID Q8WZ71
Background	The protein encoded by this gene is a member of the SEC22 family of vesicle trafficking proteins. It is localized at the endoplasmic reticulum and it is thought to play a role in the early stages of the ER-Golgi protein trafficking. There are two alternat
Synonyms	BBP; p40BBP; RIS1
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Rat: 86%; Mouse: 86%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.