ARID3C Rabbit Polyclonal Antibody

CAT#: TA339645

Rabbit Polyclonal Anti-ARID3C Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (4)
Transient overexpression lysate of AT rich interactive domain 3C (BRIGHT-like) (ARID3C)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human AT rich interactive domain 3C (BRIGHT-like) (ARID3C), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human AT rich interactive domain 3C (BRIGHT-like) (ARID3C), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-ARID3C antibody: synthetic peptide directed towards the C terminal of human ARID3C. Synthetic peptide located within the following region: MGPMDPPRPCMPPSFLPRGKVPLREERLDGPLNLAGSGISSINMALEING
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 44 kDa
Gene Name AT-rich interaction domain 3C
Background ARID3C is a member of the ARID (AT-rich interaction domain) family of proteins. The ARID domain is a helix-turn-helix motif-based DNA-binding domain. ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification.This gene is a member of the ARID (AT-rich interaction domain) family of proteins. The ARID domain is a helix-turn-helix motif-based DNA-binding domain. ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-318 AL450283.16 15235-15552 c 319-391 AL450283.16 13280-13352 c 392-575 AL450283.16 11402-11585 c 576-865 AL450283.16 10963-11252 c 866-1048 AL450283.16 9885-10067 c 1049-1138 AL450283.16 9558-9647 c 1139-1239 AL450283.16 8996-9096 c
Synonyms AT rich interactive domain 3C (BRIGHT- like); AT rich interactive domain 3C (BRIGHT-like)
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Bovine: 92%; Guinea pig: 86%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...