ZNF829 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-DKFZp779O175 antibody: synthetic peptide directed towards the N terminal of human DKFZp779O175. Synthetic peptide located within the following region: LEQGKEPWMVDRELTRGLCSDLESMCETKILSLKKRHFSQVIITREDMST
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	50 kDa
Gene Name	zinc finger protein 829
Database Link	NP_001032309 Entrez Gene 374899 Human UniProt ID Q3KNS6
Background	The exact function of DKFZp779O175 remains unknown.
Synonyms	DKFZp686K21248; DKFZp779O175; FLJ27459; MGC129866; MGC129867
Note	Immunogen Sequence Homology: Dog: 100%; Human: 100%; Horse: 93%; Bovine: 93%; Pig: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.