LIMD1 Rabbit Polyclonal Antibody
CAT#: TA339713
Rabbit Polyclonal Anti-LIMD1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
Specifications
| Product Data | |
| Applications | IHC, WB |
| Recommend Dilution | WB, IHC |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-LIMD1 antibody: synthetic peptide directed towards the N terminal of human LIMD1. Synthetic peptide located within the following region: MDKYDDLGLEASKFIEDLNMYEASKDGLFRVDKGAGNNPEFEETRRVFAT |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | lot specific |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 56 kDa |
| Gene Name | LIM domains containing 1 |
| Database Link | |
| Background | LIMD1 may be involved in cell anchoring via focal adhesions and in the cell cycle, particularly during mitosis. LIMD1 functionally interacts with pRB and the loss of which promotes lung carcinogenesis. Some breast tumors also have altered expression of LIMD1 RNA. LIMD1 may represent a critical tumor suppressor gene. |
| Synonyms | LIM domains containing 1 |
| Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%; Dog: 93%; Rabbit: 86% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
