PTOV1 Rabbit Polyclonal Antibody
CAT#: TA339725
Rabbit Polyclonal Anti-PTOV1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-PTOV1 antibody: synthetic peptide directed towards the N terminal of human PTOV1. Synthetic peptide located within the following region: DSTAKLKRTLPCQAYVNQGENLETDQWPQKLIMQLIPQQLLTTLGPLFRN |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 47 kDa |
Gene Name | prostate tumor overexpressed 1 |
Database Link | |
Background | PTOV1 belongs to the Mediator complex subunit 25 family, PTOV1 subfamily. It may activate transcription and is required for nuclear translocation of FLOT1. PTOV1 promotes cell proliferation. |
Synonyms | ACID2; PTOV-1 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |