BRF2 Rabbit Polyclonal Antibody
CNY 4628.00
CNY 3080.00
                                                
                                                
                                                
                                                    CNY 300.00 
                                                    
                                                    CNY 1430.00
                                                
                                            
                                                
                                                
                                                
                                                    CNY 2900.00 
                                                    
                                                    CNY 6650.00
                                                
                                            
CNY 9998.00
Specifications
| Product Data | |
| Applications | WB | 
| Recommend Dilution | WB | 
| Reactivity | Human | 
| Host | Rabbit | 
| Clonality | Polyclonal | 
| Immunogen | The immunogen for anti-BRF2 antibody: synthetic peptide directed towards the middle region of human BRF2. Synthetic peptide located within the following region: PPCMLKSPKRICPVPPVSTVTGDENISDSEIEQYLRTPQEVRDFQRAQAA | 
| Isotype | IgG | 
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.  | 
        
| Concentration | lot specific | 
| Purification | Affinity Purified | 
| Conjugation | Unconjugated | 
| Storage Condition | Store at -20°C as received. | 
| Predicted Protein Size | 46 kDa | 
| Gene Name | BRF2, RNA polymerase III transcription initiation factor 50 kDa subunit | 
| Database Link | |
| Background | BRF2 is the general activator of RNA polymerase III transcription. BRF2 is the factor exclusively required for RNA polymerase III transcription of genes with promoter elements upstream of the initiation sites. | 
| Synonyms | BRFU; TFIIIB50 | 
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100% | 
| Reference Data | |
| Protein Families | Druggable Genome | 
Documents
| Product Manuals | 
| FAQs | 
| SDS | 
Resources
| 抗体相关资料 | 
