ZC3H15 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZC3H15 antibody: synthetic peptide directed towards the middle region of human ZC3H15. Synthetic peptide located within the following region: SGREVFEFRPELVNDDDEEADDTRYTQGTGGDEVDDSVSVNDIDLSLYIP
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	48 kDa
Gene Name	zinc finger CCCH-type containing 15
Database Link	NP_060941 Entrez Gene 55854 Human UniProt ID Q8WU90
Background	ZC3H15 belongs to the ZC3H15/TMA46 family. It contains 2 C3H1-type zinc fingers. ZC3H15 protects DRG1 from proteolytic degradation.
Synonyms	HT010; LEREPO4; MSTP012
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Bovine: 93%; Yeast: 90%; Zebrafish: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.