ARID5B Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ARID5B antibody: synthetic peptide directed towards the C terminal of human ARID5B. Synthetic peptide located within the following region: VSPLDPSKEVSGKEKASEQESEGSKAAHGGHSGGGSEGHKLPLSSPIFPG
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	132 kDa
Gene Name	AT-rich interaction domain 5B
Database Link	NP_115575 Entrez Gene 84159 Human UniProt ID Q14865
Background	ARID5B is a DNA-binding protein that binds to the 5'-AATA[CT]-3' core sequence. ARID5B probably acts as a transcription regulator. ARID5B represses the cytomegalovirus enhancer. Overexpression of ARID5B leads to induction of smooth muscle marker genes, suggesting that it may act as a regulator of smooth muscle cell differentiation and proliferation. ARID5B may be involved in lipid stores.
Synonyms	DESRT; MRF-2; MRF2
Note	Immunogen Sequence Homology: Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Mouse: 93%; Pig: 86%; Guinea pig: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.