TCEAL2 Rabbit Polyclonal Antibody

CAT#: TA339784

Rabbit Polyclonal Anti-TCEAL2 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (4)
Transient overexpression lysate of transcription elongation factor A (SII)-like 2 (TCEAL2)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human transcription elongation factor A (SII)-like 2 (TCEAL2), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human transcription elongation factor A (SII)-like 2 (TCEAL2), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-TCEAL2 antibody: synthetic peptide directed towards the N terminal of human TCEAL2. Synthetic peptide located within the following region: MEKLFNENEGMPSNQGKIDNEEQPPHEGKPEVACILEDKKLENEGNTENT
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 26 kDa
Gene Name transcription elongation factor A like 2
Background TCEAL2 is a member of the transcription elongation factor A (SII)-like (TCEAL) gene family. Members of this family contain TFA domains and may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner.This gene encodes a member of the transcription elongation factor A (SII)-like (TCEAL) gene family. Members of this family contain TFA domains and may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. Multiple family members are located on the X chromosome.
Synonyms my048; MY0876G05; WEX1
Note Immunogen Sequence Homology: Human: 100%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...