C19orf2 (URI1) Rabbit Polyclonal Antibody

CAT#: TA339790

Rabbit Polyclonal Anti-URI1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (3)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Purified recombinant protein of Homo sapiens chromosome 19 open reading frame 2 (C19orf2), transcript variant 1, 20 µg
    • 20 ug

CNY 2900.00


Transient overexpression lysate of chromosome 19 open reading frame 2 (C19orf2), transcript variant 1
    • 100 ug

CNY 4840.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-C19orf2 antibody: synthetic peptide directed towards the middle region of human C19orf2. Synthetic peptide located within the following region: NGEYVPRKSILKSRSRENSVCSDTSESSAAEFDDRRGVLRSISCEEATCS
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 55 kDa
Gene Name URI1 prefoldin-like chaperone
Background The function of the C19orf2 protein remains unknown.The protein encoded by this gene binds to RNA polymerase II subunit 5 (RPB5) and negatively modulates transcription through its binding to RPB5. The encoded protein seems to have inhibitory effects on various types of activated transcription, but it requires the RPB5-binding region. This protein acts as a corepressor. It is suggested that it may require signaling processes for its function or that it negatively modulates genes in the chromatin structure. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Synonyms FLJ10575; NNX3; RMP; URI
Note Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Pig: 93%; Bovine: 93%; Guinea pig: 93%; Dog: 86%; Horse: 86%; Rat: 80%; Mouse: 79%
Reference Data
Protein Families Transcription Factors
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...