ZNF362 Rabbit Polyclonal Antibody
CAT#: TA339803
Rabbit Polyclonal Anti-ZNF362 Antibody
Need it in bulk or conjugated? 
                            Get a free quote
                        
CNY 5250.00
                                                
                                                
                                                
                                                    CNY 300.00 
                                                    
                                                    CNY 1430.00
                                                
                                            
                                                
                                                
                                                
                                                    CNY 2900.00 
                                                    
                                                    CNY 6650.00
                                                
                                            
Specifications
| Product Data | |
| Applications | WB | 
| Recommend Dilution | WB | 
| Reactivity | Human | 
| Host | Rabbit | 
| Clonality | Polyclonal | 
| Immunogen | The immunogen for Anti-ZNF362 antibody is: synthetic peptide directed towards the N-terminal region of Human ZNF362. Synthetic peptide located within the following region: PSQLDNLVLINKIKEQLMAEKIRPPHLPPTSASSQQPLLVPPAPAESSQA | 
| Isotype | IgG | 
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. | 
| Concentration | lot specific | 
| Purification | Affinity Purified | 
| Conjugation | Unconjugated | 
| Storage Condition | Store at -20°C as received. | 
| Predicted Protein Size | 46 kDa | 
| Gene Name | zinc finger protein 362 | 
| Database Link | |
| Background | ZNF362 may be involved in transcriptional regulation. | 
| Synonyms | lin-29; RN | 
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79% | 
| Reference Data | |
Documents
| Product Manuals | 
| FAQs | 
| SDS | 
Resources
| 抗体相关资料 | 

 
                        
 
        