ZNF784 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF784 antibody: synthetic peptide directed towards the middle region of human ZNF784. Synthetic peptide located within the following region: ERVHTGERPYHCGICGKGFTQSSVLSGHARIHTGERPFRCTLCDRTFNNS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	34 kDa
Gene Name	zinc finger protein 784
Database Link	NP_976308 Entrez Gene 147808 Human UniProt ID Q8NCA9
Background	ZNF784 may be involved in transcriptional regulation.
Synonyms	MGC75238
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Bovine: 93%; Zebrafish: 91%; Rabbit: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.