ASCL4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ASCL4 antibody: synthetic peptide directed towards the N terminal of human ASCL4. Synthetic peptide located within the following region: METRKPAERLALPYSLRTAPLGVPGTLPGLPRRDPLRVALRLDAACWEWA
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	19 kDa
Gene Name	achaete-scute family bHLH transcription factor 4
Database Link	NP_982260 Entrez Gene 121549 Human UniProt ID Q6XD76
Background	ASCL4, a basic helix-loop-helix transcription factor, is essential for the determination of cell fate and the development and differentiation of numerous tissues. It could be a transcriptional regulator involved in skin development.Basic helix-loop-helix transcription factors, such as ASCL4, are essential for the determination of cell fate and the development and differentiation of numerous tissues (Jonsson et al., 2004 [PubMed 15475265]). [supplied by OMIM]
Synonyms	bHLHa44; HASH4
Note	Immunogen Sequence Homology: Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.