PHC1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-DKFZp686A1782 antibody is: synthetic peptide directed towards the C-terminal region of Human DKFZp686A1782. Synthetic peptide located within the following region: PLSVRAGHGERDLGNPNTAPPTPELHGINPVFLSSNPSRWSVEEVYEFIA
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	67 kDa
Gene Name	polyhomeotic homolog 1
Database Link	NP_004417 Entrez Gene 1911 Human UniProt ID P78364
Background	This gene is a homolog of the Drosophila polyhomeotic gene, which is a member of the Polycomb group of genes. The gene product is a component of a multimeric protein complex that contains EDR2 and the vertebrate Polycomb protein BMH1. The gene product, the EDR2 protein, and the Drosophila polyhomeotic protein share 2 highly conserved domains, named homology domains I and II. These domains are involved in protein-protein interactions and may mediate heterodimerization of the protein encoded by this gene and the EDR2 protein.
Synonyms	EDR1; HPH1; MCPH11; RAE28
Note	Immunogen Sequence Homology: Horse: 100%; Human: 100%; Bovine: 100%; Dog: 93%; Pig: 93%; Rabbit: 93%; Rat: 86%
Reference Data
Protein Families	ES Cell Differentiation/IPS, Stem cell - Pluripotency

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.