Dysferlin interacting protein 1 (PPP1R27) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-DYSFIP1 antibody: synthetic peptide directed towards the middle region of human DYSFIP1. Synthetic peptide located within the following region: CSDGYPDIARYLISLGADRDATNDDGDLPSDLIDPDYKELVELFKGTTMD
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	17 kDa
Gene Name	protein phosphatase 1 regulatory subunit 27
Database Link	NP_001007534 Entrez Gene 116729 Human UniProt ID Q86WC6
Background	The exact function of DYSFIP1 remains unknown.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.
Synonyms	DYSFIP1
Note	Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 93%; Pig: 86%; Horse: 86%; Bovine: 86%; Guinea pig: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.