ROPN1B Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ROPN1B antibody: synthetic peptide directed towards the N terminal of human ROPN1B. Synthetic peptide located within the following region: DYFEALSRGETPPVRERSERVALCNWAELTPELLKILHSQVAGRLIIRAE
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	24 kDa
Gene Name	rhophilin associated tail protein 1B
Database Link	NP_001012337 Entrez Gene 152015 Human UniProt ID Q9BZX4
Background	ROPN1B belongs to the ropporin family and contains 1 RIIa domain. ROPN1B interacts with RHPN1 and AKAP3. It may interact with SPA17.
Synonyms	AKAP-binding sperm protein ropporin; rhophilin associated protein 1B; ropporin
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Mouse: 92%; Zebrafish: 83%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.