LRRC17 Rabbit Polyclonal Antibody
CAT#: TA339973
Rabbit Polyclonal Anti-LRRC17 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
Cited in 1 publication. |
CNY 300.00
CNY 1430.00
CNY 3080.00
CNY 3080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-LRRC17 antibody: synthetic peptide directed towards the middle region of human LRRC17. Synthetic peptide located within the following region: YVFPIQTLDCKRKELKKVPNNIPPDIVKLDLSYNKINQLRPKEFEDVHEL |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 52 kDa |
Gene Name | leucine rich repeat containing 17 |
Database Link | |
Background | LRRC17 contains 6 LRR (leucine-rich) repeats. The exact function of LRRC17 remains unknown. |
Synonyms | P37NB |
Note | Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Bovine: 93%; Rabbit: 93%; Pig: 86%; Horse: 86%; Mouse: 86%; Guinea pig: 86%; Zebrafish: 79% |
Reference Data | |
Protein Families | Druggable Genome |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
Transcriptome Profile of Membrane and Extracellular Matrix Components in Ligament-Fibroblastic Progenitors and Cementoblasts Differentiated from Human Periodontal Ligament Cells
,null,
Genes
,PubMed ID 35456465
[LRRC17]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |