PDIA6 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, IP, WB
Recommend Dilution	WB, IHC, IP
Reactivity	Human, Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PDIA6 antibody: synthetic peptide directed towards the N terminal of human PDIA6. Synthetic peptide located within the following region: KNRPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRSDSS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	48 kDa
Gene Name	protein disulfide isomerase family A member 6
Database Link	NP_005733 Entrez Gene 71853 MouseEntrez Gene 10130 Human UniProt ID Q15084
Background	Protein disulfide isomerases, such as PDIA6, are endoplasmic reticulum (ER) resident proteins that catalyze formation, reduction, and isomerization of disulfide bonds in proteins and are thought to play a role in folding of disulfide-bonded proteins.
Synonyms	ERP5; P5; TXNDC7
Note	Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Bovine: 86%; Rabbit: 79%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.