RFPL2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RFPL2 antibody: synthetic peptide directed towards the C terminal of human RFPL2. Synthetic peptide located within the following region: VSFFDAESGSHVYTFRSVSAEEPLRPFLAPSVPPNGDQGVLSICPLMNSG
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	32 kDa
Gene Name	ret finger protein like 2
Database Link	NP_001091997 Entrez Gene 10739 Human UniProt ID O75678
Background	RFPL2 contains 1 B30.2/SPRY domain and 1 RING-type zinc finger. The human RFPL2 gene has a role in neocortex development.
Synonyms	RNF79
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 85%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.