Hsp105 (HSPH1) Rabbit Polyclonal Antibody
CAT#: TA340125
Rabbit Polyclonal Anti-HSPH1 Antibody
Need it in bulk or conjugated? 
                            Get a free quote
                        
CNY 4628.00
                                                
                                                
                                                
                                                    CNY 300.00 
                                                    
                                                    CNY 1430.00
                                                
                                            
                                                
                                                
                                                
                                                    CNY 2900.00 
                                                    
                                                    CNY 6650.00
                                                
                                            
CNY 9998.00
Specifications
| Product Data | |
| Applications | WB | 
| Recommend Dilution | WB | 
| Reactivity | Human | 
| Host | Rabbit | 
| Clonality | Polyclonal | 
| Immunogen | The immunogen for anti-HSPH1 antibody: synthetic peptide directed towards the middle region of human HSPH1. Synthetic peptide located within the following region: EENEMSSEADMECLNQRPPENPDTDKNVQQDNSEAGTQPQVQTDAQQTSQ | 
| Isotype | IgG | 
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.  | 
        
| Concentration | lot specific | 
| Purification | Affinity Purified | 
| Conjugation | Unconjugated | 
| Storage Condition | Store at -20°C as received. | 
| Predicted Protein Size | 97 kDa | 
| Gene Name | heat shock protein family H (Hsp110) member 1 | 
| Database Link | |
| Background | HSPH1 prevents the aggregation of denatured proteins in cells under severe stress, on which the ATP levels decrease markedly. It inhibits HSPA8/HSC70 ATPase and chaperone activities. | 
| Synonyms | HSP105; HSP105A; HSP105B; NY-CO-25 | 
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93% | 
| Reference Data | |
| Protein Families | Stem cell - Pluripotency | 
Documents
| Product Manuals | 
| FAQs | 
| SDS | 
Resources
| 抗体相关资料 | 
