TWF2 Rabbit Polyclonal Antibody

CAT#: TA340173

Rabbit Polyclonal Anti-TWF2 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (4)
Transient overexpression lysate of twinfilin, actin-binding protein, homolog 2 (Drosophila) (TWF2)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human twinfilin, actin-binding protein, homolog 2 (Drosophila) (TWF2), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human twinfilin, actin-binding protein, homolog 2 (Drosophila) (TWF2), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-TWF2 antibody is: synthetic peptide directed towards the C-terminal region of Human TWF2. Synthetic peptide located within the following region: IGDGAELTAEFLYDEVHPKQHAFKQAFAKPKGPGGKRGHKRLIRGPGENG
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 38 kDa
Gene Name twinfilin actin binding protein 2
Background The protein encoded by this gene was identified by its interaction with the catalytic domain of protein kinase C-zeta. The encoded protein contains an actin-binding site and an ATP-binding site. It is most closely related to twinfilin (PTK9), a conserved actin monomer-binding protein.
Synonyms A6r; A6RP; MSTP011; PTK9L
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 86%; Zebrafish: 86%
Reference Data
Protein Families Druggable Genome
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...