VPS26B Rabbit Polyclonal Antibody
CAT#: TA340216
Rabbit Polyclonal Anti-VPS26B Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-VPS26B antibody: synthetic peptide directed towards the C terminal of human VPS26B. Synthetic peptide located within the following region: AGYELTPTMRDINKKFSVRYYLNLVLIDEEERRYFKQQEVVLWRKGDIVR |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | lot specific |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 39 kDa |
| Gene Name | VPS26 retromer complex component B |
| Database Link | |
| Background | VPS26B belongs to the VPS26 family. VPS26B is probable component of the retromer complex, a complex required to retrieve lysosomal enzyme receptors (IGF2R and M6PR) from endosomes to the trans-Golgi network. |
| Synonyms | Pep8b |
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%; Zebrafish: 93%; Yeast: 86%; Goat: 79% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
