GBP4 Rabbit Polyclonal Antibody
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-GBP4 antibody: synthetic peptide directed towards the middle region of human GBP4. Synthetic peptide located within the following region: NAVTALAQLENPAAVQRAADHYSQQMAQQLRLPTDTLQELLDVHAACERE |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 45 kDa |
Gene Name | guanylate binding protein 4 |
Database Link | |
Background | GBP4 belongs to the GBP family. It binds GTP, GDP and GMP. Hydrolyzes GTP very efficiently; GDP rather than GMP is the major reaction product. GBP4 plays a role in erythroid differentiation. |
Synonyms | Mpa2 |
Note | Immunogen Sequence Homology: Human: 100%; Rat: 93%; Mouse: 93%; Bovine: 93%; Pig: 91%; Guinea pig: 91%; Dog: 86%; Rabbit: 86%; Horse: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |