NCE2 (UBE2F) Rabbit Polyclonal Antibody
CAT#: TA340245
Rabbit Polyclonal Anti-UBE2F Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-UBE2F antibody: synthetic peptide directed towards the middle region of human UBE2F. Synthetic peptide located within the following region: TLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDYIKRYA |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 21 kDa |
Gene Name | ubiquitin conjugating enzyme E2 F (putative) |
Database Link | |
Background | UBE2F belongs to the ubiquitin-conjugating enzyme family. UBE2F accepts the ubiquitin-like protein NEDD8 from the UBA3-NAE1 E1 complex and catalyzes its covalent attachment to other proteins. |
Synonyms | NCE2 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Yeast: 79% |
Reference Data | |
Protein Pathways | Ubiquitin mediated proteolysis |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |