Phostensin (PPP1R18) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-PPP1R18 antibody is: synthetic peptide directed towards the C-terminal region of Human PPP1R18. Synthetic peptide located within the following region: PEDAGTGGLRQQEEEAVELQPPPPAPLSPPPPAPTAPQPPGDPLMSRLFY
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	68 kDa
Gene Name	protein phosphatase 1 regulatory subunit 18
Database Link	NP_597728 Entrez Gene 170954 Human UniProt ID Q6NYC8
Background	Protein phosphatase-1 interacts with regulatory subunits that target the enzyme to different cellular locations and change its activity toward specific substrates. Phostensin is a regulatory subunit that targets PP1 to F-actin cytoskeleton.
Synonyms	HKMT1098; KIAA1949
Note	Immunogen Sequence Homology: Human: 100%; Pig: 93%; Horse: 86%; Bovine: 79%; Rabbit: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.