SPATA17 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SPATA17 antibody: synthetic peptide directed towards the C terminal of human SPATA17. Synthetic peptide located within the following region: NMFLPFSSYHKNEKYIPSMHLSSKYGPISYKEQFRSENPKKWICDKDFQT
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	43 kDa
Gene Name	spermatogenesis associated 17
Database Link	NP_620151 Entrez Gene 128153 Human UniProt ID Q96L03
Background	SPATA17 contains 3 IQ domains. The function of the SPATA17 protein is not known.
Synonyms	IQCH; MSRG-11; MSRG11
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 91%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.