DPPA2 Rabbit Polyclonal Antibody
CAT#: TA340320
Rabbit Polyclonal Anti-DPPA2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-DPPA2 antibody: synthetic peptide directed towards the N terminal of human DPPA2. Synthetic peptide located within the following region: NMEQMEPSVSSTSDVKLEKPKKYNPGHLLQTNEQFTAPQKARCKIPALPL |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 34 kDa |
Gene Name | developmental pluripotency associated 2 |
Database Link | |
Background | DPPA2 may play a role in maintaining cell pluripotentiality. ECSA/DPPA2 is a promising target for antigen-specific immunotherapy in non-small cell lung cancers. |
Synonyms | CT100; ECAT15-2; PESCRG1 |
Note | Immunogen Sequence Homology: Human: 100%; Rat: 90% |
Reference Data | |
Protein Families | Embryonic stem cells, Induced pluripotent stem cells, Stem cell - Pluripotency |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |