CFAP251 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-WDR66 antibody: synthetic peptide directed towards the N terminal of human WDR66. Synthetic peptide located within the following region: GELEEKTDRMPQDELGQERRDLEPENREEGQERRVSDIQSKAGISRESLV
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	130 kDa
Gene Name	WD repeat domain 66
Database Link	NP_653269 Entrez Gene 144406 Human UniProt ID Q8TBY9
Background	WDR66 contains 9 WD repeats. The functions of WDR66 remain unknown.
Synonyms	CaM-IP4
Note	Immunogen Sequence Homology: Dog: 100%; Human: 100%; Pig: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.