EFHB Rabbit Polyclonal Antibody
CNY 5250.00
Cited in 1 publication. |
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-EFHB antibody is: synthetic peptide directed towards the C-terminal region of Human EFHB. Synthetic peptide located within the following region: YGEEGSAYSLLYPTIFARKGVFERDFFKTRSKEEIAEILCNIGVKLSDEE |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 77 kDa |
Gene Name | EF-hand domain family member B |
Database Link | |
Background | The function of this protein remains unknown. |
Synonyms | CFAP21 |
Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93% |
Reference Data |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
EFHB is a Novel Cytosolic Ca2+ Sensor That Modulates STIM1-SARAF Interaction
,Albarran, L;Lopez, JJ;Jardin, I;Sanchez-Collado, J;Berna-Erro, A;Smani, T;Camello, PJ;Salido, GM;Rosado, JA;,
Cell. Physiol. Biochem.
,PubMed ID 30481768
[EFHB]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |