CCDC52 (SPICE1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SPICE1 antibody: synthetic peptide directed towards the middle region of human SPICE1. Synthetic peptide located within the following region: KEQNWEEKTLPIDTDIQNSSEENRLFTQRWRVSHMGEDLENKTQAPFVNL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	96 kDa
Gene Name	spindle and centriole associated protein 1
Database Link	NP_653319 Entrez Gene 152185 Human UniProt ID Q8N0Z3
Background	The specific function of SPICE1 is not yet known.
Synonyms	CCDC52; SPICE
Note	Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Pig: 93%; Rat: 93%; Rabbit: 93%; Guinea pig: 93%; Horse: 92%; Dog: 79%; Bovine: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.