ARHGAP36 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ARHGAP36 antibody: synthetic peptide directed towards the N terminal of human ARHGAP36. Synthetic peptide located within the following region: KPDRALPIDRPNTLDKWFLILRGQQRAVSHKTFGISLEEVLVNEFTRRKH
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	62 kDa
Gene Name	Rho GTPase activating protein 36
Database Link	NP_659404 Entrez Gene 158763 Human UniProt ID Q6ZRI8
Background	ARHGAP36 is the GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.
Synonyms	RP13-102H20.1
Note	Immunogen Sequence Homology: Human: 100%; Horse: 93%; Rabbit: 93%; Mouse: 86%; Pig: 83%; Goat: 79%; Sheep: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.