ARL13B Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ARL13B antibody: synthetic peptide directed towards the middle region of human ARL13B. Synthetic peptide located within the following region: VEPLNIDDCAPESPTPPPPPPPVGWGTPKVTRLPKLEPLGETHHNDFYRK
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	36 kDa
Gene Name	ADP ribosylation factor like GTPase 13B
Database Link	NP_659433 Entrez Gene 200894 Human UniProt ID Q3SXY8
Background	ARL13B has an evolutionarily conserved role mediating cilia function in multiple organs. N and C domains of ARL13B cooperatively regulate its ciliary localization and that N domain-dependent self-association of Arl13b may be important for its function in cilia biogenesis.
Synonyms	ARL2L1; JBTS8
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Guinea pig: 100%; Dog: 93%; Rat: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Horse: 79%; Zebrafish: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.