MHF2 (CENPX) Rabbit Polyclonal Antibody
CAT#: TA340377
Rabbit Polyclonal Anti-STRA13 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-STRA13 antibody: synthetic peptide directed towards the middle region of human STRA13. Synthetic peptide located within the following region: MEGAGAGSGFRKELVSRLLHLHFKDDKTKEAAVRGVRQAQAEDALRVDVD |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 7 kDa |
Gene Name | stimulated by retinoic acid 13 |
Database Link | |
Background | STRA13 is a DNA-binding component of the FA core complex involved in DNA damage repair and genome maintenance.STRA13 is recruited to forks stalled by DNA interstrand cross-links, and required for cellular resistance to such lesions. As a component of the APITD1/CENPS complex,STRA13 is also essential for the stable assembly of the outer kinetchore. |
Synonyms | CENP-X; D9; FAAP10; MHF2; STRA13 |
Note | Immunogen Sequence Homology: Human: 100% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |